PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.005G156900.2
Common NameB456_005G156900, LOC105794369
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARR-B
Protein Properties Length: 670aa    MW: 72631.7 Da    PI: 6.816
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.005G156900.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.53e-28229282155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv+av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQk+Rl
  Gorai.005G156900.2 229 KPRVVWSVELHQQFVSAVNQL-GIDKAVPKRILELMNVPGLTRENVASHLQKFRL 282
                         79*******************.********************************8 PP

2Response_reg77.93.6e-26451531109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl+vdD+ + +++l+q+l + +y +v+++ +++ al+ll+e++  +D+il D+ mp+mdG++ll++   e  +lp+i+++a g+   + + 
  Gorai.005G156900.2  45 VLVVDDDITCLKILEQMLHRCRY-HVTTCPQAKVALNLLRERKgcFDVILSDVYMPDMDGYKLLEHVGLEM-DLPVIMMSADGSTRAVMKG 133
                         89*********************.*******************************************6644.8****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         ++ Ga d+l Kp+ +eel +
  Gorai.005G156900.2 134 IRHGACDYLIKPIREEELKN 153
                         *****************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363925.1E-16414655IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23004.5E-4242180No hitNo description
SuperFamilySSF521727.68E-3642171IPR011006CheY-like superfamily
SMARTSM004485.4E-3043155IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.27544159IPR001789Signal transduction response regulator, receiver domain
PfamPF000726.7E-2345153IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.36E-2646158No hitNo description
PROSITE profilePS5129411.209226285IPR017930Myb domain
SuperFamilySSF466891.25E-19226286IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.6E-30226287IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-24229282IPR006447Myb domain, plants
PfamPF002499.7E-7231280IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 670 aa     Download sequence    Send to blast
MATMHRVVQS SVSTSDATTT SYDGLTSCKA ADIVISDQFP AGLRVLVVDD DITCLKILEQ  60
MLHRCRYHVT TCPQAKVALN LLRERKGCFD VILSDVYMPD MDGYKLLEHV GLEMDLPVIM  120
MSADGSTRAV MKGIRHGACD YLIKPIREEE LKNIWQHVVR KKWNENKELE HSGSLDDTDQ  180
HKQRHDDAEY ASSVNDATET SLKPLKKRSN SKEEDDGEID NDDPSTSKKP RVVWSVELHQ  240
QFVSAVNQLG IDKAVPKRIL ELMNVPGLTR ENVASHLQKF RLYLKRISGV AQQGGIANPL  300
CGPVEANVKI GSLGSFNIQA LAASGQIPPQ TLAALHAELL GRSAGNLVVA TDQPALLQAT  360
PQGPKCIQVD HGVAFVQHSV KSESSSSKHF SQSFAPVEDV ASGFRSWPSN NIGTAGPSNS  420
GGLSSQNGNM LIDLLQQQQQ LQKPQQRSTV SELRRSINVQ PSCHVVPSQS SASFRAGNSP  480
VSVTQNGSYS RTAVIDYSLL SSQSNCPSLN IGQVSDVNLQ TTGVLSGYIP PASVSPSVSS  540
CSVNADNCAS QQVQTSSMTF KASRRLPGFV HSTSNIPDPY GSTKSGDLLN QEPFNNLGYI  600
NKGTCLPAKF AVDEFQSHLS SSSHGKVFSE NIGTRVKQEP SMEFGDNAKV GIPMLQQFPP  660
NDLMSVFTE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-23225288164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012478974.10.0PREDICTED: two-component response regulator-like APRR3
SwissprotQ8H7S71e-160ORR21_ORYSJ; Two-component response regulator ORR21
TrEMBLA0A0D2SHT00.0A0A0D2SHT0_G
STRINGVIT_01s0011g05830.t010.0(Vitis vinifera)
STRINGPOPTR_0010s11600.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-122response regulator 2
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]